Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMO Peptide - N-terminal region

KMO Peptide - N-terminal region

Product Specifications

UniProt

O15229

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KMO Rabbit Polyclonal Antibody (orb585839) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKKPRFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANK1 Protein Vector (Human) (pPB-C-His)
PV030009 500 ng

PANK1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CD3-γ HDR Plasmid (m)
sc-419555-HDR 20 µg

CD3-γ HDR Plasmid (m)

Sign In for Pricing
View Details
Tmem185a Rat siRNA Oligo Duplex (Locus ID 309357)
SR506315 1 Kit

Tmem185a Rat siRNA Oligo Duplex (Locus ID 309357)

Sign In for Pricing
View Details
GCM2 Rabbit Polyclonal Antibody (BF555)
orb2525750 100 µL

GCM2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
OPCA03274-500UG - HA-17 Recombinant Protein
OPCA03274-500UG 500 µg

OPCA03274-500UG - HA-17 Recombinant Protein

Sign In for Pricing
View Details
LiquiThief 1000mm 190mL sample vol HDPE
SAM0124 20 / PCK

LiquiThief 1000mm 190mL sample vol HDPE

Sign In for Pricing
View Details