Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 32 (SIM32), partial

This Recombinant Human Small integral membrane protein 32 (SIM32), partial spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 32 SMIM32

UniProt

A0A1B0GUA5

Expression Region

1-54

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGDIFNATGGPEAAVGSALAPGATVKAEGALPLELATARGMRDGAATKPDLPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LapB Polyclonal Antibody, FITC Conjugated
A53834-050 50 µL

LapB Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Human GRIP2 shRNA Plasmid
abx962932-01 150 µg

Human GRIP2 shRNA Plasmid

Sign In for Pricing
View Details
Human GRIP2 shRNA Plasmid
abx962932-02 300 µg

Human GRIP2 shRNA Plasmid

Sign In for Pricing
View Details
Recombinant human LC3B/MAP1LC3B protein
ATGP1039-020 20 µg

Recombinant human LC3B/MAP1LC3B protein

Sign In for Pricing
View Details
KRTAP10-6 Human shRNA Plasmid Kit (Locus ID 386674)
TL303617 1 Kit

KRTAP10-6 Human shRNA Plasmid Kit (Locus ID 386674)

Sign In for Pricing
View Details
PCDHGC3 (NM_002588) Human Over-expression Lysate
LC419228 20 µg

PCDHGC3 (NM_002588) Human Over-expression Lysate

Sign In for Pricing
View Details