Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial, Biotinylated

This Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial, Biotinylated spans the amino acid sequence from region 776-875. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-protein ligase E3A; EC 2.3.2.26; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A E6AP EPVE6AP HPVE6A

UniProt

Q05086

Expression Region

776-875

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PY-60
S9861-25mg 25 mg

PY-60

Sign In for Pricing
View Details
RNU7-12P 3'UTR GFP Stable Cell Line
TU070235 1.0 mL

RNU7-12P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FARSB (1-589, His-tag) Human Protein
AR51781PU-N 500 µg

FARSB (1-589, His-tag) Human Protein

Sign In for Pricing
View Details
Human NAV2 knockout cell line
ABC-KH9868 1 Vial

Human NAV2 knockout cell line

Sign In for Pricing
View Details
NMU Rabbit pAb
A21782 20 µL

NMU Rabbit pAb

Sign In for Pricing
View Details
PI 3-Kinase p85, NT-SH3 (Phosphatidylinositol-PI-3-Kinase) (AP)
MBS6241509-01 0.1 mL

PI 3-Kinase p85, NT-SH3 (Phosphatidylinositol-PI-3-Kinase) (AP)

Sign In for Pricing
View Details