Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial, Biotinylated

This Recombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial, Biotinylated spans the amino acid sequence from region 186-347. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent phosphate transport protein 2A; Sodium-phosphate transport protein 2A; Na (+-dependent phosphate cotransporter 2A; NaPi-3; Sodium/phosphate cotransporter 2A; Na (+/Pi cotransporter 2A; NaPi-2a; Solute carrier family 34 member 1; SLC34A1 NPT2 SLC17A2

UniProt

Q06495

Expression Region

186-347

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Defb19 protein
orb705055-01 20 µg

Mouse Defb19 protein

Sign In for Pricing
View Details
Mouse Defb19 protein
orb705055-02 100 µg

Mouse Defb19 protein

Sign In for Pricing
View Details
Mouse Defb19 protein
orb705055-03 1 mg

Mouse Defb19 protein

Sign In for Pricing
View Details
STNL W012-150x50-PP-CRD/1 Electrical & Equipment Safety Signs (No Adhesive)
828138 1 Card (1 Panel (s) x 1 Pack)

STNL W012-150x50-PP-CRD/1 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
Rabbit Polyclonal FNIP1 Antibody [Janelia Fluor 669]
NBP3-18249JF669 0.1 mL

Rabbit Polyclonal FNIP1 Antibody [Janelia Fluor 669]

Sign In for Pricing
View Details
Recombinant Rhodopseudomonas palustris Protein translocase subunit SecA (secA), partial
MBS1108346 Inquire

Recombinant Rhodopseudomonas palustris Protein translocase subunit SecA (secA), partial

Sign In for Pricing
View Details