Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Defb19 protein

This Mouse Defb19 protein spans the amino acid sequence from region 20-83aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BD-19; mBD-19; Defensin, beta 19; Testis-specific beta-defensin-like protein

UniProt

Q8K3I8

Expression Region

20-83aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus DNA topoisomerase 3 (topB), partial
MBS1365389 Inquire

Recombinant Staphylococcus aureus DNA topoisomerase 3 (topB), partial

Sign In for Pricing
View Details
1- (Phenylsulphonyl) pyrrolidine
OR59413 1 Each

1- (Phenylsulphonyl) pyrrolidine

Sign In for Pricing
View Details
Vmn2r83 (NM_001104537) Mouse Tagged ORF Clone
MG213474 10 µg

Vmn2r83 (NM_001104537) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Pro-MMP-9 ELISA Kit
E064525 1 Each

Mouse Pro-MMP-9 ELISA Kit

Sign In for Pricing
View Details
CDK4 Antibody [Knockout Validated]
orb1926162-01 50 µL

CDK4 Antibody [Knockout Validated]

Sign In for Pricing
View Details
CDK4 Antibody [Knockout Validated]
orb1926162-02 100 µL

CDK4 Antibody [Knockout Validated]

Sign In for Pricing
View Details