Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62), Biotinylated

This Recombinant Human T cell receptor beta variable 6-2 (TVB62), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (CEA31), CF405S conjugate, 0.1mg/mL
BNC040670-100 1x 100 µL

CD66 (CEA) (CEA31), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHF11 Rabbit Polyclonal Antibody
TA379867 100 µL

PHF11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLCA4 Human Gene Knockout Kit (CRISPR)
KN415626 1 Kit

CLCA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS635864 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Bulk Anti-Human CD119 (GIR 208) Antibody
ICH1028-25mg 25 mg

Bulk Anti-Human CD119 (GIR 208) Antibody

Sign In for Pricing
View Details
Recombinant Human CCL14a/HCC-1 Protein (Sumo Tag)
PDEH100598-01 20 µg

Recombinant Human CCL14a/HCC-1 Protein (Sumo Tag)

Sign In for Pricing
View Details