Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated

This Recombinant Human T cell receptor delta variable 1 (TRDV1), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI6C3]
CF805385 100 µg

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI6C3]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189US-01 25 µg

Elab Fluor® Red 780 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse IgD Antibody[11-26c.2a]
E-AB-F1189US-02 100 µg

Elab Fluor® Red 780 Anti-Mouse IgD Antibody[11-26c.2a]

Sign In for Pricing
View Details
AR A014418
SIH-492-5MG 5 mg

AR A014418

Sign In for Pricing
View Details
Human Spectrin beta 5 (SPTBN5) activation kit by CRISPRa
GA109747 1 Kit

Human Spectrin beta 5 (SPTBN5) activation kit by CRISPRa

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), Biotin conjugate, 0.1mg/mL
BNCB0144-100 1x 100 µL

Borrelia burgdorferi (p41 Flagellin) (6802), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details