Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated

This Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-2/delta variable 8 TRAV38-2DV8

UniProt

A0JD32

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bafilomycin B1
TRC-B110005-1MG 1 mg

Bafilomycin B1

Sign In for Pricing
View Details
Recombinant Cynomolgus Thymic Stromal Lymphopoietin/TSLP (C-6His)
PKSQ050102-01 10 µg

Recombinant Cynomolgus Thymic Stromal Lymphopoietin/TSLP (C-6His)

Sign In for Pricing
View Details
Recombinant Cynomolgus Thymic Stromal Lymphopoietin/TSLP (C-6His)
PKSQ050102-02 50 µg

Recombinant Cynomolgus Thymic Stromal Lymphopoietin/TSLP (C-6His)

Sign In for Pricing
View Details
S6K1 (RPS6KB1) Human Gene Knockout Kit (CRISPR)
KN217324RB 1 Kit

S6K1 (RPS6KB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stathmin 1 (STMN1) pSer15 Rabbit Polyclonal Antibody
AP02492PU-N 100 µL

Stathmin 1 (STMN1) pSer15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS804723 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details