Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated

This Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CEBPZOS; CEBPZ antisense RNA 1; CEBPZ opposite strand; CEBPZOS CEBPZ-AS1

UniProt

A8MTT3

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Contactin 4
311766 100 µL

Contactin 4

Sign In for Pricing
View Details
Melanoma Inhibitory Activity Rabbit Polyclonal Antibody (APC)
orb1002082 100 µL

Melanoma Inhibitory Activity Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
SLC25A31 Antibody
MBS9605199-01 0.1 mL

SLC25A31 Antibody

Sign In for Pricing
View Details
SLC25A31 Antibody
MBS9605199-02 0.2 mL

SLC25A31 Antibody

Sign In for Pricing
View Details
SLC25A31 Antibody
MBS9605199-03 5x 0.2 mL

SLC25A31 Antibody

Sign In for Pricing
View Details
TG 100801
orb1708359-01 1 mg

TG 100801

Sign In for Pricing
View Details