Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079), Biotinylated

This Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079), Biotinylated spans the amino acid sequence from region 1-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC01619 LINC01619 C12orf79

UniProt

G3V211

Expression Region

1-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25A pSer279 Rabbit Polyclonal Antibody
AP12578PU-N 400 µL

CDC25A pSer279 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF405S conjugate, 0.1mg/mL
BNC042266-500 1x 500 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®568 Goat anti-Alpaca IgG, VHH, 1 mg/mL
#20883-100uL 1x 100 µL

CF®568 Goat anti-Alpaca IgG, VHH, 1 mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), Biotin conjugate, 0.1mg/mL
BNCB1531-100 1x 100 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human IL-32α Protein (Trx Tag)
PDEH100654-01 20 µg

Recombinant Human IL-32α Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human IL-32α Protein (Trx Tag)
PDEH100654-02 100 µg

Recombinant Human IL-32α Protein (Trx Tag)

Sign In for Pricing
View Details