Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 18 (SIM18), partial, Biotinylated

This Recombinant Human Small integral membrane protein 18 (SIM18), partial, Biotinylated spans the amino acid sequence from region 56-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 18 SMIM18

UniProt

P0DKX4

Expression Region

56-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YEVLDCCCCVKNKTVKDLKSEPNPLRSMMDNIRKRETEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCN2 Antibody, FITC conjugated
A17442-50UG 50 µg

CLCN2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Rno-miR-29a-5p miRNA Mimic
orb1874005-01 5 nmol

Rno-miR-29a-5p miRNA Mimic

Sign In for Pricing
View Details
Rno-miR-29a-5p miRNA Mimic
orb1874005-02 10 nmol

Rno-miR-29a-5p miRNA Mimic

Sign In for Pricing
View Details
RUFY1 Human Over-expression Lysate
orb1351094 100 µg

RUFY1 Human Over-expression Lysate

Sign In for Pricing
View Details
FadL Recombinant Protein
OPCA03325-100UG 100 µg

FadL Recombinant Protein

Sign In for Pricing
View Details
AKT (Phospho-T72) Rabbit Polyclonal Antibody
orb515492-01 30 µL

AKT (Phospho-T72) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details