Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FadL Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Long-chain fatty acid outer membrane transporter

Gene Aliases

ECs_3227; long-chain fatty acid outer membrane transporter; Outer membrane FadL protein; Outer membrane flp protein.

Gene ID

915676

Accession Number

NP_311254.1

Reactivity

Escherichia coli

Target

Involved in translocation of long-chain fatty acids across the outer membrane. FadL may form a specific channel (By similarity) .

Type

Protein

Source

E.coli

Sequence

AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGKTPQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRVFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

61.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FadL

Host or Source

Escherichia coli

Protein Name

Long-chain fatty acid transport protein

Gene Name URL

FadL

Nucleotide Accession Number

NC_002695.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Histone H1.3 ELISA kit
GTR10401694 96 Well

Monkey Histone H1.3 ELISA kit

Sign In for Pricing
View Details
Hsf2 (NM_031694) Rat Tagged ORF Clone Lentiviral Particle
RR210514L4V 200 µL

Hsf2 (NM_031694) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Chlamydia Trachomatis LPS (MaxLight 490)
MBS6253751-01 0.1 mL

Chlamydia Trachomatis LPS (MaxLight 490)

Sign In for Pricing
View Details
Chlamydia Trachomatis LPS (MaxLight 490)
MBS6253751-02 5x 0.1 mL

Chlamydia Trachomatis LPS (MaxLight 490)

Sign In for Pricing
View Details
Human peroxisome proliferators activator receptors alpha,PPAR-α ELISA Kit
CN-03743H2 48T

Human peroxisome proliferators activator receptors alpha,PPAR-α ELISA Kit

Sign In for Pricing
View Details
PRDM14 shRNA Plasmid (h)
sc-77737-SH 20 µg

PRDM14 shRNA Plasmid (h)

Sign In for Pricing
View Details