Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Helix-loop-helix protein 2 (HEN2)

This Recombinant Human Helix-loop-helix protein 2 (HEN2) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein 2; HEN-2; Class A basic helix-loop-helix protein 34; bHLHa34; Nescient helix loop helix 2; NSCL-2; NHLH2 BHLHA34 HEN2 KIAA0490

UniProt

Q02577

Expression Region

1-135

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UbcH13/Uev1A Protein, Active
B2018852 5 µg

UbcH13/Uev1A Protein, Active

Sign In for Pricing
View Details
Rabbit Collagen Type II Alpha 1 ELISA kit
GTR10441600 96 Well

Rabbit Collagen Type II Alpha 1 ELISA kit

Sign In for Pricing
View Details
Serine/Arginine-rich splicing Factor 5 (SFRS5) Human ELISA Kit
G9779 96 Tests

Serine/Arginine-rich splicing Factor 5 (SFRS5) Human ELISA Kit

Sign In for Pricing
View Details
ZNF500 Recombinant Protein (Human)
RP045187 100 µg

ZNF500 Recombinant Protein (Human)

Sign In for Pricing
View Details
Fish Ribonuclease K6 (RNASE6) ELISA Kit
MBS9380647 Inquire

Fish Ribonuclease K6 (RNASE6) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhesus Macaque GSTM3 Protein, His (Fc)-Avi-tagged
GSTM3-1814R 50 µg

Recombinant Rhesus Macaque GSTM3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details