Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribosomal RNA-processing protein 7 homolog A (RRP7A)

This Recombinant Human Ribosomal RNA-processing protein 7 homolog A (RRP7A) spans the amino acid sequence from region 1-280. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribosomal RNA-processing protein 7 homolog A; Gastric cancer antigen Zg14; RRP7A CGI-96

UniProt

Q9Y3A4

Expression Region

1-280

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSRKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF423 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV704389 1.0 µg DNA

ZNF423 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Spopl 3'UTR GFP Stable Cell Line
TU271113 1.0 mL

Spopl 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LRRK2-IN-3
HY-145318 1 Each

LRRK2-IN-3

Sign In for Pricing
View Details
Y-26763
C04794-1mg 1 mg

Y-26763

Sign In for Pricing
View Details
CHDI-390576 50mg
A18899-50 50 mg

CHDI-390576 50mg

Sign In for Pricing
View Details
SOX12 (Transcription Factor SOX-12, Protein SOX-22, SOX22) (AP) discontinued
133714-AP 100 µL

SOX12 (Transcription Factor SOX-12, Protein SOX-22, SOX22) (AP) discontinued

Sign In for Pricing
View Details