Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17)

This Recombinant Human Immunoglobulin kappa variable 1D-17 (KVD17) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-17 IGKV1D-17

UniProt

A0A075B6S4

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NIQMTQSPSAMSASVGDRVTITCRARQGISNYLAWFQQKPGKVPKHLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Jejunum
CR559594 5 µg

Tissue Total RNA, Jejunum

Sign In for Pricing
View Details
Optitrol HSV 2
SR13035 1 mL

Optitrol HSV 2

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9) (NM_001216) Human Over-expression Lysate
LY400485 100 µg

Carbonic Anhydrase IX (CA9) (NM_001216) Human Over-expression Lysate

Sign In for Pricing
View Details
DFNA5 / GSDME Rabbit Polyclonal Antibody
ER1901-12 100 µL

DFNA5 / GSDME Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CT47A1 (NM_001080146) Human Over-expression Lysate
LY421602 100 µg

CT47A1 (NM_001080146) Human Over-expression Lysate

Sign In for Pricing
View Details
Myoneurin (MYNN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B9]
TA800195BM 100 µL

Myoneurin (MYNN) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B9]

Sign In for Pricing
View Details