Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372)

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HC-030031
SIH-303-10MG 10 mg

HC-030031

Sign In for Pricing
View Details
(±)-2-Hydroxydodecanoic Acid
TRC-H296750-50MG 50 mg

(±)-2-Hydroxydodecanoic Acid

Sign In for Pricing
View Details
Tissue Total RNA, Breast, left
CR562567 5 µg

Tissue Total RNA, Breast, left

Sign In for Pricing
View Details
RACGAP1 (NM_001126104) Human Over-expression Lysate
LY426646 100 µg

RACGAP1 (NM_001126104) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CTSL (Cathepsin L) ELISA Kit
E-EL-H0671-01 24 Tests

Human CTSL (Cathepsin L) ELISA Kit

Sign In for Pricing
View Details
Human CTSL (Cathepsin L) ELISA Kit
E-EL-H0671-02 48 Tests

Human CTSL (Cathepsin L) ELISA Kit

Sign In for Pricing
View Details