Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 27 (TVB27)

This Recombinant Human T cell receptor beta variable 27 (TVB27) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 27 TRBV27

UniProt

A0A0K0K1C4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCYOX1 Antibody
27-767 100 µL

PCYOX1 Antibody

Sign In for Pricing
View Details
TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (MaxLight 405)
MBS6358533-01 0.1 mL

TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (MaxLight 405)

Sign In for Pricing
View Details
TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (MaxLight 405)
MBS6358533-02 5x 0.1 mL

TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (MaxLight 405)

Sign In for Pricing
View Details
Human H2A Histone Family, Member J (H2AFJ) Protein
abx066970-01 10 µg

Human H2A Histone Family, Member J (H2AFJ) Protein

Sign In for Pricing
View Details
Human H2A Histone Family, Member J (H2AFJ) Protein
abx066970-02 50 µg

Human H2A Histone Family, Member J (H2AFJ) Protein

Sign In for Pricing
View Details
Human H2A Histone Family, Member J (H2AFJ) Protein
abx066970-03 100 µg

Human H2A Histone Family, Member J (H2AFJ) Protein

Sign In for Pricing
View Details