Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGFG1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
11513126 3x 1.0µg DNA

AGFG1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Rabbit anti-IDH3 alpha Antibody
DL94434A-01 50 µL

Rabbit anti-IDH3 alpha Antibody

Sign In for Pricing
View Details
Rabbit anti-IDH3 alpha Antibody
DL94434A-02 100 µL

Rabbit anti-IDH3 alpha Antibody

Sign In for Pricing
View Details
Mouse Monoclonal BOP1 Antibody (T7-P1B7/A8) [DyLight 755]
NBP2-50124IR 0.1 mL

Mouse Monoclonal BOP1 Antibody (T7-P1B7/A8) [DyLight 755]

Sign In for Pricing
View Details
Mouse CD153 Antibody (FITC)
GWB-B770D8 0.5 mg

Mouse CD153 Antibody (FITC)

Sign In for Pricing
View Details
PCIF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1610808 1.0 µg DNA

PCIF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details