Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 130B (D130B)

This Recombinant Human Beta-defensin 130B (D130B) spans the amino acid sequence from region 23-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 130B DEFB130B

UniProt

P0DP73

Expression Region

23-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A8]
TA807619BM 100 µL

CDCA8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A8]

Sign In for Pricing
View Details
NACA (NM_001113202) Human Over-expression Lysate
LC426389 20 µg

NACA (NM_001113202) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Factor B, C-His Tag
HA211099-01 Inquire

Human Factor B, C-His Tag

Sign In for Pricing
View Details
Human Factor B, C-His Tag
HA211099-02 100 µg

Human Factor B, C-His Tag

Sign In for Pricing
View Details
A83-01
SIH-423-25MG 25 mg

A83-01

Sign In for Pricing
View Details
MIR423 Human qPCR Primer Pair (MI0001445)
HP300357 200 Reactions

MIR423 Human qPCR Primer Pair (MI0001445)

Sign In for Pricing
View Details