Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative pro-MCH-like protein 2 (MCHL2)

This Recombinant Human Putative pro-MCH-like protein 2 (MCHL2) spans the amino acid sequence from region 1-86. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative pro-MCH-like protein 2; Pro-melanin-concentrating hormone-like protein 2; PMCHL2

UniProt

Q9BQD1

Expression Region

1-86

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLSQKTKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTLEKRETGDEENSAKFPIGRRDFDTLRCMLGRVYQRCWQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (Nuclear Marker) (r1415-1), CF405S conjugate, 0.1mg/mL
BNC041797-500 1x 500 µL

Histone H1 (Nuclear Marker) (r1415-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Kynurenic Acid
TRC-K660500-500MG 500 mg

Kynurenic Acid

Sign In for Pricing
View Details
Recombinant Human Desmin Protein (His Tag)
PKSH032351-01 10 µg

Recombinant Human Desmin Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Desmin Protein (His Tag)
PKSH032351-02 50 µg

Recombinant Human Desmin Protein (His Tag)

Sign In for Pricing
View Details
HNF6 (ONECUT1) Rabbit Polyclonal Antibody
TA372739 100 µL

HNF6 (ONECUT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FCGRT (NM_004107) Human Over-expression Lysate
LC401327 20 µg

FCGRT (NM_004107) Human Over-expression Lysate

Sign In for Pricing
View Details