Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 13 (TFLM)

This Recombinant Human TATA-box-binding protein-associated factor 11-like protein 13 (TFLM) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TATA-box-binding protein-associated factor 11-like protein 13 TAF11L13

UniProt

A0A1W2PPH5

Expression Region

1-198

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEEPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKRKKERKPTVDAEEAQRMTTLLSAMSEEQLSRYEVCRRSAFPRARIAGLMRSITGSSVSENAAIAMAGIAKVFVGEVVEEALDMCEMWGETPPLQPKHLREAVHRLKPKGLFPNSNYKRVMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS-CoV-2 S2 Protein (ECD, Fc Tag)
PKSR030517 100 µg

Recombinant SARS-CoV-2 S2 Protein (ECD, Fc Tag)

Sign In for Pricing
View Details
Lactulose Fluorometric Assay Kit
E-BC-F049 96 T (40 samples)

Lactulose Fluorometric Assay Kit

Sign In for Pricing
View Details
Recombinant CBX7 Antibody
RC-15686-01 50 μL

Recombinant CBX7 Antibody

Sign In for Pricing
View Details
Recombinant CBX7 Antibody
RC-15686-02 100 µL

Recombinant CBX7 Antibody

Sign In for Pricing
View Details
Recombinant CBX7 Antibody
RC-15686-03 1 mL

Recombinant CBX7 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS501231 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details