Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS802247 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
MTH1 Recombinant Rabbit Monoclonal Antibody [PSH02-40]
HA721817 100 µL

MTH1 Recombinant Rabbit Monoclonal Antibody [PSH02-40]

Sign In for Pricing
View Details
Human TMEM185A activation kit by CRISPRa
GA113593 1 Kit

Human TMEM185A activation kit by CRISPRa

Sign In for Pricing
View Details
CD66 (CEA) (CEA31), CF405S conjugate, 0.1mg/mL
BNC040670-100 1x 100 µL

CD66 (CEA) (CEA31), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Mouse CD134 (OX-86) In Vivo Antibody - Low Endotoxin
ICH1196-5mg 5 mg

Anti-Mouse CD134 (OX-86) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
CD74 (CLIP/813), CF640R conjugate, 0.1mg/mL
BNC400813-100 1x 100 µL

CD74 (CLIP/813), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details