Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 5 (SPRR5)

This Recombinant Human Small proline-rich protein 5 (SPRR5) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 5 SPRR5

UniProt

A0A1B0GTR4

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF2BPL Polyclonal Antibody
MBS9235935-01 0.1 mL

IRF2BPL Polyclonal Antibody

Sign In for Pricing
View Details
IRF2BPL Polyclonal Antibody
MBS9235935-02 5x 0.1 mL

IRF2BPL Polyclonal Antibody

Sign In for Pricing
View Details
GRSF1 Recombinant Rabbit mAb
E43S47615 100 µL

GRSF1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
UBOX5 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
49036154 3x 1.0 µg DNA

UBOX5 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Lentiviral human TMED8 shRNA (UAS) - Lentiviral human TMED8 shRNA (UAS, GFP) (100)
GTR15100845 1 Vial

Lentiviral human TMED8 shRNA (UAS) - Lentiviral human TMED8 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Cytokeratin 5/6/18 Antibody
V8319-100UG 100 µg

Cytokeratin 5/6/18 Antibody

Sign In for Pricing
View Details