Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-A9 (S10A9), Biotinylated

This Recombinant Human Protein S100-A9 (S10A9), Biotinylated spans the amino acid sequence from region 1-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-A9; Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9; S100A9 CAGB CFAG MRP14

UniProt

P06702

Expression Region

1-114

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HNRNPK Antibody (Biotin Conjugate)
32784-05121 150 µg

Human HNRNPK Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
GPR6 rabbit pAb
ES11476-01 50 µL

GPR6 rabbit pAb

Sign In for Pricing
View Details
GPR6 rabbit pAb
ES11476-02 100 µL

GPR6 rabbit pAb

Sign In for Pricing
View Details
Anti-Human APP Nanobody (SAA1209)
RHC12501 100 μg

Anti-Human APP Nanobody (SAA1209)

Sign In for Pricing
View Details
ISOC1
CSB-CL839302HU1 10 μg Plasmid + 200 μL Glycerol

ISOC1

Sign In for Pricing
View Details
DHDPSL HDR Plasmid (h)
sc-410248-HDR 20 µg

DHDPSL HDR Plasmid (h)

Sign In for Pricing
View Details