Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated

This Recombinant Human Testis-specific Y-encoded protein 1 (TSPY1), Biotinylated spans the amino acid sequence from region 1-308. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-specific Y-encoded protein 1; Cancer/testis antigen 78; CT78; TSPY1 TSPY

UniProt

Q01534

Expression Region

1-308

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUZP4 Human Gene Knockout Kit (CRISPR)
KN415624 1 Kit

LUZP4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SGK1 (NM_001143678) Human Over-expression Lysate
LY428314 100 µg

SGK1 (NM_001143678) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-MMP12 Antibody [SR03-23]
ET1602-42TR 20 µL

Anti-MMP12 Antibody [SR03-23]

Sign In for Pricing
View Details
Glucagon-d9 Trifluoroacetate
TRC-G412202-1MG 1 mg

Glucagon-d9 Trifluoroacetate

Sign In for Pricing
View Details
Human MAGEE2 activation kit by CRISPRa
GA115345 1 Kit

Human MAGEE2 activation kit by CRISPRa

Sign In for Pricing
View Details
PSME2 Recombinant Rabbit Monoclonal Antibody [PSH0-10]
HA721263 100 µL

PSME2 Recombinant Rabbit Monoclonal Antibody [PSH0-10]

Sign In for Pricing
View Details