Recombinant Human Histone-lysine N-methyltransferase 2A (KMT2A), partial, Biotinylated
This Recombinant Human Histone-lysine N-methyltransferase 2A (KMT2A), partial, Biotinylated spans the amino acid sequence from region 1635-1765. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Histone-lysine N-methyltransferase 2A; Lysine N-methyltransferase 2A; EC 2.1.1.364; ALL-1; CXXC-type zinc finger protein 7; Cysteine methyltransferase KMT2A; EC 2.1.1.-; Myeloid/lymphoid or mixed-lineage leukemia; Myeloid/lymphoid or mixed-lineage leukemia protein 1; Trithorax-like protein; Zinc finger protein HRX; [Cleaved into: MLL cleavage product N320; N-terminal cleavage product of 320 kDa; p320; MLL cleavage product C180; C-terminal cleavage product of 180 kDa; p180] KMT2A ALL1 CXXC7 HRX HTRX MLL MLL1 TRX1
UniProt
Q03164
Expression Region
1635-1765
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin; Pharmacology & Drug Discovery
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
ALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog