Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Alkaline Phosphatase (ALPL) Rabbit pAb (APR19026N)

Product Specifications

Background

This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific) . The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Alkaline Phosphatase (ALPL) Rabbit pAb (APR19026N) .

Synonyms

ALPL; AP-TNAP; APTNAP; HOPS; TNAP

Gene ID

249

UniProt

P05186

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa/51kDa/57kDa Observed MW: 80KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=249

Uniprot URL

https://www.uniprot.org/uniprot/P05186

AA Sequence

ILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prpf38b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3058602 1.0 µg DNA

Prpf38b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)
MBS1020881-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)
MBS1020881-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)
MBS1020881-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)
MBS1020881-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)
MBS1020881-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Holo-[acyl-carrier-protein] synthase (acpS)

Sign In for Pricing
View Details