Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 2-33 (LV233), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 2-33 IGLV2-33

UniProt

A0A075B6J2

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSALTQPPFVSGAPGQSVTISCTGTSSDVGDYDHVFWYQKRLSTTSRLLIYNVNTRPSGISDLFSGSKSGNMASLTISGLKSEVEANYHCSLYSSSYTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human USP17L2 Recombinant Protein, N-His
ARO-P20144-01 50 µg

Human USP17L2 Recombinant Protein, N-His

Sign In for Pricing
View Details
Human USP17L2 Recombinant Protein, N-His
ARO-P20144-02 100 µg

Human USP17L2 Recombinant Protein, N-His

Sign In for Pricing
View Details
Human USP17L2 Recombinant Protein, N-His
ARO-P20144-03 1 mg

Human USP17L2 Recombinant Protein, N-His

Sign In for Pricing
View Details
Vinblastine
AB0144 20 mg

Vinblastine

Sign In for Pricing
View Details
Axin 2 Antibody, mAb, Rabbit
A03613-100 100 µL

Axin 2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
PD-1/PD-L1-IN-41
HY-162343 1 Each

PD-1/PD-L1-IN-41

Sign In for Pricing
View Details