Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated

This Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated spans the amino acid sequence from region 22-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 23/delta variable 6 TRAV23DV6

UniProt

A0A075B6W5

Expression Region

22-121

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Peptide YY (PYY) ELISA Kit
MBS2801846-01 48 Tests

Canine Peptide YY (PYY) ELISA Kit

Sign In for Pricing
View Details
Canine Peptide YY (PYY) ELISA Kit
MBS2801846-02 96 Tests

Canine Peptide YY (PYY) ELISA Kit

Sign In for Pricing
View Details
Canine Peptide YY (PYY) ELISA Kit
MBS2801846-03 5x 96 Tests

Canine Peptide YY (PYY) ELISA Kit

Sign In for Pricing
View Details
Canine Peptide YY (PYY) ELISA Kit
MBS2801846-04 10x 96 Tests

Canine Peptide YY (PYY) ELISA Kit

Sign In for Pricing
View Details
Fragilis Rabbit Polyclonal Antibody (BF555)
orb1598497 100 µL

Fragilis Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
MTHFR Mouse Monoclonal Antibody [Clone ID: LBI2B4]
AMM20851VCF 100 µg

MTHFR Mouse Monoclonal Antibody [Clone ID: LBI2B4]

Sign In for Pricing
View Details