Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 5 (TRGV5), Biotinylated

This Recombinant Human T cell receptor gamma variable 5 (TRGV5), Biotinylated spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 5 TRGV5 TCRGV5

UniProt

A0A0B4J1U4

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGGTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slfn8 Mouse shRNA Lentiviral Particle (Locus ID 276950)
TL519850V 500 µL Each

Slfn8 Mouse shRNA Lentiviral Particle (Locus ID 276950)

Sign In for Pricing
View Details
Naltrexone 3-Methyl Ether
460527 25 mg

Naltrexone 3-Methyl Ether

Sign In for Pricing
View Details
(S, R, S) -AHPC-Ala-CO-cyclohexene-Bpin
HY-163954 1 Each

(S, R, S) -AHPC-Ala-CO-cyclohexene-Bpin

Sign In for Pricing
View Details
Phospho-MKK3 (Ser218) + MKK6 (Ser207) Rabbit Polyclonal Antibody (BF350)
orb2432060 100 µL

Phospho-MKK3 (Ser218) + MKK6 (Ser207) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Phospho-SYK-Y352/ZAP70-Y319 Rabbit pAb
MBS8550635-01 0.1 mL

Phospho-SYK-Y352/ZAP70-Y319 Rabbit pAb

Sign In for Pricing
View Details
Phospho-SYK-Y352/ZAP70-Y319 Rabbit pAb
MBS8550635-02 0.1 mL (AF405L)

Phospho-SYK-Y352/ZAP70-Y319 Rabbit pAb

Sign In for Pricing
View Details