Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-2 (TVB62), Biotinylated

This Recombinant Human T cell receptor beta variable 6-2 (TVB62), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-2 TRBV6-2

UniProt

A0A0J9YXY3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diisopropyl Fluorophosphate
TRC-D455300-2.5G 2.5 g

Diisopropyl Fluorophosphate

Sign In for Pricing
View Details
TRF1 (TERF1) (NM_003218) Human Over-expression Lysate
LY418833 100 µg

TRF1 (TERF1) (NM_003218) Human Over-expression Lysate

Sign In for Pricing
View Details
Fibronectin (2755-8), Biotin conjugate, 0.1mg/mL
BNCB0091-500 1x 500 µL

Fibronectin (2755-8), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Usmg5 (NM_023211) Mouse Tagged ORF Clone
MG200029 10 µg

Usmg5 (NM_023211) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Flotillin-2 Recombinant Rabbit Monoclonal Antibody [PSH03-41]
HA721986 100 µL

Flotillin-2 Recombinant Rabbit Monoclonal Antibody [PSH03-41]

Sign In for Pricing
View Details
ITGB1BP2 Antibody
KC-1364-01 50 μL

ITGB1BP2 Antibody

Sign In for Pricing
View Details