Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Art5 Mouse Gene Knockout Kit (CRISPR)
KN501634 1 Kit

Art5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL
BNC741205-100 1x 100 µL

Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
eIF4A2 Recombinant Rabbit Monoclonal Antibody [PSH01-88]
HA721746 100 µL

eIF4A2 Recombinant Rabbit Monoclonal Antibody [PSH01-88]

Sign In for Pricing
View Details
Kidins220 Rabbit Polyclonal Antibody
ER1902-65 100 µL

Kidins220 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRRC50 (DNAAF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E2]
TA504577AM 100 µL

LRRC50 (DNAAF1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Pancreas
CS503254 5x 5 µm

Frozen Tissue Sections, Pancreas

Sign In for Pricing
View Details