Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated

This Recombinant Human DDIT3 upstream open reading frame protein (DT3UO), Biotinylated spans the amino acid sequence from region 1-34. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DDIT3 upstream open reading frame protein; Alternative DDIT3 protein; AltDDIT3; DDIT3

UniProt

P0DPQ6

Expression Region

1-34

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLKMSGWQRQSQNQSWNLRRECSRRKCIFIHHHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b Recombinant Rabbit Monoclonal Antibody [JE58-34]
HA720043 100 µL

CD79b Recombinant Rabbit Monoclonal Antibody [JE58-34]

Sign In for Pricing
View Details
ALDOB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]
TA502804BM 100 µL

ALDOB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details
FAK (PTK2) Rabbit Polyclonal Antibody
AP09515PU-S 50 µL

FAK (PTK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant SOD2 (Acetyl Lys68) Monoclonal Antibody
AN301412L-01 50 µL

Recombinant SOD2 (Acetyl Lys68) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SOD2 (Acetyl Lys68) Monoclonal Antibody
AN301412L-02 100 µL

Recombinant SOD2 (Acetyl Lys68) Monoclonal Antibody

Sign In for Pricing
View Details
2-Aminothiazole-4-carboxamide (~15% Inorganics)
TRC-A633288-500MG 500 mg

2-Aminothiazole-4-carboxamide (~15% Inorganics)

Sign In for Pricing
View Details