Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated

This Recombinant Human Transmembrane protein 225B (T225B), partial, Biotinylated spans the amino acid sequence from region 168-221. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 225B TMEM225B

UniProt

P0DP42

Expression Region

168-221

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Mucosae-associated Epithelial Chemokine/CCL28
P1476-.005 5 µg

Recombinant Human Mucosae-associated Epithelial Chemokine/CCL28

Sign In for Pricing
View Details
MMADHC AAV siRNA Pooled Vector
30223161 1.0 µg

MMADHC AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Motexafin gadolinium
T33487 25 mg

Motexafin gadolinium

Sign In for Pricing
View Details
LAIR1 Protein (C-His, Human)
P521331 100 µg

LAIR1 Protein (C-His, Human)

Sign In for Pricing
View Details
MitoSOX Red
MBS5817264 Inquire

MitoSOX Red

Sign In for Pricing
View Details
TTC35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV716382 1.0 µg DNA

TTC35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details