Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger CCCH domain-containing protein 11C (ZC11C), partial, Biotinylated

This Recombinant Human Zinc finger CCCH domain-containing protein 11C (ZC11C), partial, Biotinylated spans the amino acid sequence from region 1-500. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger CCCH domain-containing protein 11C ZC3H11C

UniProt

P0DQW0

Expression Region

1-500

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRRVCRFRHMEIDKKRSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSKSVLPTVPESPEEEVKASQLSVQQNKLSVQSNPSPQLRSVMKVESSENVPSPKHPPVVINAADDDEDDDDQFSEEGDETKTPTLQPTPEVHNGLRVTSVRKPAVNIKQGECLHFGIKTLEEIKSKKMKEKSEEQGEGSSGVSSLLLHPEPVPGPEKENVRTVVRTVTLSTKQGEEPLVRLGLTETLGKRKFSTGGDSDPPLKRSLAQRLGKKVEAPETNTDETPKKAQVSKSLKERLGMSADPNNEDATDKVNKVGEIHVKTLEEMLLERASQKHGESQTKLKTEGPSKTDDSTSGARSSSTIRIKTFSEVLAEEEHRQQEAERQKSKKDTTCIKLKTDSEIKKTVVLPPIVASKGQSEEPAGKTKSMQEVHMKTVEEIKLEKALRVQQSSESSTSSPSQHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RRM2B/P53R2 Protein (His Tag)
PKSH030709 100 µg

Recombinant Human RRM2B/P53R2 Protein (His Tag)

Sign In for Pricing
View Details
EN1 (NM_001426) Human Over-expression Lysate
LC419942 20 µg

EN1 (NM_001426) Human Over-expression Lysate

Sign In for Pricing
View Details
Lrrc20 (NM_153542) Mouse Tagged ORF Clone
MG201700 10 µg

Lrrc20 (NM_153542) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR560509 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Recombinant Human DYNLL1 Protein (His Tag)
PKSH032338-01 10 µg

Recombinant Human DYNLL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DYNLL1 Protein (His Tag)
PKSH032338-02 50 µg

Recombinant Human DYNLL1 Protein (His Tag)

Sign In for Pricing
View Details