Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tudor domain-containing protein 15 (TDR15), partial, Biotinylated

This Recombinant Human Tudor domain-containing protein 15 (TDR15), partial, Biotinylated spans the amino acid sequence from region 1011-1070. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tudor domain-containing protein 15 TDRD15

UniProt

B5MCY1

Expression Region

1011-1070

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSNKMRVCISKYVEDGLSYRALAIPTDSSSEFQVYFVDFGNKQLVGENMLRAISAQFPEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diexf (NM_145415) Mouse Tagged ORF Clone Lentiviral Particle
MR216881L4V 200 µL

Diexf (NM_145415) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Exoenzyme C3, clostridium botulinum
HY-P2325 25 µg

Exoenzyme C3, clostridium botulinum

Sign In for Pricing
View Details
STEAP3 (Metalloreductase STEAP3, Tumor Suppressor-activated Pathway Protein 6, STMP3, TSAP6, Dudlin-2) (AP)
MBS6439322-01 0.1 mL

STEAP3 (Metalloreductase STEAP3, Tumor Suppressor-activated Pathway Protein 6, STMP3, TSAP6, Dudlin-2) (AP)

Sign In for Pricing
View Details
STEAP3 (Metalloreductase STEAP3, Tumor Suppressor-activated Pathway Protein 6, STMP3, TSAP6, Dudlin-2) (AP)
MBS6439322-02 5x 0.1 mL

STEAP3 (Metalloreductase STEAP3, Tumor Suppressor-activated Pathway Protein 6, STMP3, TSAP6, Dudlin-2) (AP)

Sign In for Pricing
View Details
Rabbit Anti-phospho-Histone H3 (Thr45) antibody
SL17442R-01 50 µL

Rabbit Anti-phospho-Histone H3 (Thr45) antibody

Sign In for Pricing
View Details
Rabbit Anti-phospho-Histone H3 (Thr45) antibody
SL17442R-02 100 µL

Rabbit Anti-phospho-Histone H3 (Thr45) antibody

Sign In for Pricing
View Details