Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small lysine-rich protein 1 (SMKR1), Biotinylated

This Recombinant Human Small lysine-rich protein 1 (SMKR1), Biotinylated spans the amino acid sequence from region 1-65. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small lysine-rich protein 1 SMKR1

UniProt

H3BMG3

Expression Region

1-65

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Peroxiredoxin 5 Antibody
DL98037A-01 50 µL

Rabbit anti-Peroxiredoxin 5 Antibody

Sign In for Pricing
View Details
Rabbit anti-Peroxiredoxin 5 Antibody
DL98037A-02 100 µL

Rabbit anti-Peroxiredoxin 5 Antibody

Sign In for Pricing
View Details
Anti-MIM Rabbit pAb
GB112181 100 μL

Anti-MIM Rabbit pAb

Sign In for Pricing
View Details
Human Vascular Endothelial Growth Factor Receptor 2 CLIA Kit
MBS8426049-01 1 Kit

Human Vascular Endothelial Growth Factor Receptor 2 CLIA Kit

Sign In for Pricing
View Details
Human Vascular Endothelial Growth Factor Receptor 2 CLIA Kit
MBS8426049-02 5x 1 Kit

Human Vascular Endothelial Growth Factor Receptor 2 CLIA Kit

Sign In for Pricing
View Details
SYT4 Polyclonal Antibody
E-AB-10617-01 20 µL

SYT4 Polyclonal Antibody

Sign In for Pricing
View Details