Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial

This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent dopamine transporter; DA transporter; DAT; Solute carrier family 6 member 3; SLC6A3 DAT1

UniProt

Q01959

Expression Region

172-236

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pkdcc Mouse qPCR Primer Pair (NM_134117)
MP204572 200 Reactions

Pkdcc Mouse qPCR Primer Pair (NM_134117)

Sign In for Pricing
View Details
CHS1 Polyclonal Antibody, FITC Conjugated
A54635-100 100 µL

CHS1 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Doxorubicin (DOX) HCl
S1208-1g 1 g

Doxorubicin (DOX) HCl

Sign In for Pricing
View Details
NRP1 (Neuropilin 1) Porcine ELISA Kit
F4380 96 Tests

NRP1 (Neuropilin 1) Porcine ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD3E Antibody (OKT3)
MBS1564184-01 0.05 mg

Anti-Human CD3E Antibody (OKT3)

Sign In for Pricing
View Details
Anti-Human CD3E Antibody (OKT3)
MBS1564184-02 0.1 mg

Anti-Human CD3E Antibody (OKT3)

Sign In for Pricing
View Details