Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Helix-loop-helix protein 2 (HEN2)

This Recombinant Human Helix-loop-helix protein 2 (HEN2) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein 2; HEN-2; Class A basic helix-loop-helix protein 34; bHLHa34; Nescient helix loop helix 2; NSCL-2; NHLH2 BHLHA34 HEN2 KIAA0490

UniProt

Q02577

Expression Region

1-135

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Breast Matched Tumor & Normal Tissue Lysate - (Dry Ice)
NBP2-47106 2 Vials

Breast Matched Tumor & Normal Tissue Lysate - (Dry Ice)

Sign In for Pricing
View Details
FAXC Peptide - C-terminal region
orb2002766 100 µg

FAXC Peptide - C-terminal region

Sign In for Pricing
View Details
Eci2 Protein Vector (Mouse) (pPM-C-His)
PV174357 500 ng

Eci2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
KAL1 Rabbit Polyclonal Antibody (PE-Cy5)
orb1014543 100 µL

KAL1 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Human/Mouse/Rat NEDD8 Affinity Purified Polyclonal Ab
AF4936 100 µg

Human/Mouse/Rat NEDD8 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
MAD2L1BP Rabbit mAb
56102 50 µL

MAD2L1BP Rabbit mAb

Sign In for Pricing
View Details