Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAXC Peptide - C-terminal region

FAXC Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAXC, C6orf168

UniProt

Q5TGI0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAXC Rabbit Polyclonal Antibody (orb326832) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115900

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Exostoses 1 (EXT1) ELISA Kit
abx252416-01 96 Tests

Human Exostoses 1 (EXT1) ELISA Kit

Sign In for Pricing
View Details
Human Exostoses 1 (EXT1) ELISA Kit
abx252416-02 5x 96 Tests

Human Exostoses 1 (EXT1) ELISA Kit

Sign In for Pricing
View Details
Human Exostoses 1 (EXT1) ELISA Kit
abx252416-03 10x 96 Tests

Human Exostoses 1 (EXT1) ELISA Kit

Sign In for Pricing
View Details
TMED2 Antibody, FITC conjugated
CSB-PA05049C0Rb-01 50 µg

TMED2 Antibody, FITC conjugated

Sign In for Pricing
View Details
TMED2 Antibody, FITC conjugated
CSB-PA05049C0Rb-02 100 µg

TMED2 Antibody, FITC conjugated

Sign In for Pricing
View Details
CDC42 sgRNA CRISPR Lentivector (Human) (Target 2)
K0003103 1.0 µg DNA

CDC42 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details