Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-16 (LV316)

This Recombinant Human Immunoglobulin lambda variable 3-16 (LV316) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-16 IGLV3-16

UniProt

A0A075B6K0

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSLGQMARITCSGEALPKKYAYWYQQKPGQFPVLVIYKDSERPSGIPERFSGSSSGTIVTLTISGVQAEDEADYYCLSADSSGTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Perflubron
HY-B1724-01 1 g

Perflubron

Sign In for Pricing
View Details
Perflubron
HY-B1724-02 10 mM - 1 mL

Perflubron

Sign In for Pricing
View Details
Mouse Monoclonal anti-human CLEC6A (Dectin-2)
hAP-1208 50 µg

Mouse Monoclonal anti-human CLEC6A (Dectin-2)

Sign In for Pricing
View Details
CHI3L2 Polyclonal Antibody, FITC Conjugated
bs-12358R-FITC 100 µL

CHI3L2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Tspan1 (NM_133681) Mouse Tagged ORF Clone Lentiviral Particle
MR202948L3V 200 µL

Tspan1 (NM_133681) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-Acetyl-4-hydroxybenzoic acid
OR90526-01 100 mg

3-Acetyl-4-hydroxybenzoic acid

Sign In for Pricing
View Details