Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cadherin 10 (CDH10) ELISA Kit
GTR10340028 96 Well

Rat Cadherin 10 (CDH10) ELISA Kit

Sign In for Pricing
View Details
Rat Leukemia Inhibitory Factor (LIF) ELISA Kit
NSL1365r 96 Tests

Rat Leukemia Inhibitory Factor (LIF) ELISA Kit

Sign In for Pricing
View Details
CD130, CT (IL6ST, Interleukin-6 receptor subunit beta, CDw130, Interleukin-6 signal transducer, Membrane glycoprotein 130, Oncostatin-M receptor subunit alpha, CD130)
033450 200 µL

CD130, CT (IL6ST, Interleukin-6 receptor subunit beta, CDw130, Interleukin-6 signal transducer, Membrane glycoprotein 130, Oncostatin-M receptor subunit alpha, CD130)

Sign In for Pricing
View Details
AIRE Antibody - middle region
ARP37991_P050-25UL 25 µL

AIRE Antibody - middle region

Sign In for Pricing
View Details
Capuramycin
HY-N15258 1 Each

Capuramycin

Sign In for Pricing
View Details
Creatine kinase B-type
AP84755 1 mg

Creatine kinase B-type

Sign In for Pricing
View Details