Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36)

This Recombinant Human T cell receptor alpha variable 36/delta variable 7 (TVA36) spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 36/delta variable 7 TRAV36DV7

UniProt

A0A075B6V5

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELFSILNITATQTGDSAIYLCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC22B, ID (SEC22B, SEC22L1, Vesicle-trafficking protein SEC22b, ER-Golgi SNARE of 24kD, SEC22 vesicle-trafficking protein homolog B, SEC22 vesicle-trafficking protein-like 1) (MaxLight 490)
MBS6345762-01 0.1 mL

SEC22B, ID (SEC22B, SEC22L1, Vesicle-trafficking protein SEC22b, ER-Golgi SNARE of 24kD, SEC22 vesicle-trafficking protein homolog B, SEC22 vesicle-trafficking protein-like 1) (MaxLight 490)

Sign In for Pricing
View Details
SEC22B, ID (SEC22B, SEC22L1, Vesicle-trafficking protein SEC22b, ER-Golgi SNARE of 24kD, SEC22 vesicle-trafficking protein homolog B, SEC22 vesicle-trafficking protein-like 1) (MaxLight 490)
MBS6345762-02 5x 0.1 mL

SEC22B, ID (SEC22B, SEC22L1, Vesicle-trafficking protein SEC22b, ER-Golgi SNARE of 24kD, SEC22 vesicle-trafficking protein homolog B, SEC22 vesicle-trafficking protein-like 1) (MaxLight 490)

Sign In for Pricing
View Details
FANCG Rabbit Polyclonal Antibody
TA326063 100 µL

FANCG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae ML0869 Protein (aa 1-229)
VAng-Yyj1741-inquire Inquire

Recombinant Mycobacterium Leprae ML0869 Protein (aa 1-229)

Sign In for Pricing
View Details
FL77-24
HY-157419 1 Each

FL77-24

Sign In for Pricing
View Details
Tubulin protein (fluorescent AMCA) - porcine brain
TL440M-B 20x 20 µg

Tubulin protein (fluorescent AMCA) - porcine brain

Sign In for Pricing
View Details