Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11)

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11) spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac1/2/3/CDC42 Polyclonal Antibody
ABP52301-01 30 µL

Rac1/2/3/CDC42 Polyclonal Antibody

Sign In for Pricing
View Details
Rac1/2/3/CDC42 Polyclonal Antibody
ABP52301-02 100 µL

Rac1/2/3/CDC42 Polyclonal Antibody

Sign In for Pricing
View Details
Rac1/2/3/CDC42 Polyclonal Antibody
ABP52301-03 200 µL

Rac1/2/3/CDC42 Polyclonal Antibody

Sign In for Pricing
View Details
6530418L21Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3509006 1.0 µg DNA

6530418L21Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PCMV-Lactb-3xFLAG-Neo Plasmid
PVT69318 2 µg

PCMV-Lactb-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Goat anti-SOX8 (aa 203 to 217) Antibody
MBS420866-01 0.1 mg

Goat anti-SOX8 (aa 203 to 217) Antibody

Sign In for Pricing
View Details