Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22)

This Recombinant Human T cell receptor alpha variable 22 (TVA22) spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22) (Biotin)
134265-Biotin 100 µL

TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22) (Biotin)

Sign In for Pricing
View Details
Boc-Gln-Ala-Arg-AMC · HCl
I-1550.0005 5.0mg

Boc-Gln-Ala-Arg-AMC · HCl

Sign In for Pricing
View Details
Biotinylated Anti-SARS-CoV-2 Spike RBD Neutralizing Antibody, Chimeric mAb, Human IgG1 (AM122) (MALS verified)
S1N-VM226-25ug 25 µg

Biotinylated Anti-SARS-CoV-2 Spike RBD Neutralizing Antibody, Chimeric mAb, Human IgG1 (AM122) (MALS verified)

Sign In for Pricing
View Details
Anti-CAPN2 Polyclonal Antibody
PHD25301 100 μg

Anti-CAPN2 Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTS13 Protein (C-3xFlag Tag, )
P510473 100 µg

ADAMTS13 Protein (C-3xFlag Tag, )

Sign In for Pricing
View Details
Polyclonal TIGAR Antibody (aa220-270)
APR02830G 0.05mg

Polyclonal TIGAR Antibody (aa220-270)

Sign In for Pricing
View Details