Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-3 (HV103)

This Recombinant Human Immunoglobulin heavy variable 1-3 (HV103) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-3 IGHV1-3

UniProt

A0A0C4DH29

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRVTITRDTSASTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Borrelia NapA
PT-A00534-01 5 µg

Borrelia NapA

Sign In for Pricing
View Details
Borrelia NapA
PT-A00534-02 20 µg

Borrelia NapA

Sign In for Pricing
View Details
Borrelia NapA
PT-A00534-03 1 mg

Borrelia NapA

Sign In for Pricing
View Details
Hmmr (NM_013552) Mouse Tagged ORF Clone
MR219106 10 µg

Hmmr (NM_013552) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CK-666
orb1309829-01 5 mg

CK-666

Sign In for Pricing
View Details
CK-666
orb1309829-02 25 mg

CK-666

Sign In for Pricing
View Details