Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-28 (HV428)

This Recombinant Human Immunoglobulin heavy variable 4-28 (HV428) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-28 IGHV4-28

UniProt

A0A0C4DH34

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSDTLSLTCAVSGYSISSSNWWGWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTMSVDTSKNQFSLKLSSVTAVDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prealbumin ELISA Kit (Human)
OKIA00081-96W 1x 96 Well Plate

Prealbumin ELISA Kit (Human)

Sign In for Pricing
View Details
HLA-DPB1 CRISPRa sgRNA lentivector (set of three targets)(Human)
23431121 3x 1.0µg DNA

HLA-DPB1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
PDGF-A Polyclonal Antibody, Cy5.5 Conjugated
bs-10073R-Cy5.5 100 µL

PDGF-A Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
ACC alpha (Phospho-S80) Antibody
E51A02746 100 µL

ACC alpha (Phospho-S80) Antibody

Sign In for Pricing
View Details
Mouse Monoclonal SERBP1 Antibody (SERBP1/3491) [Alexa Fluor 750]
NBP3-08560AF750 100 µL

Mouse Monoclonal SERBP1 Antibody (SERBP1/3491) [Alexa Fluor 750]

Sign In for Pricing
View Details
Camk1d Mouse shRNA Plasmid (Locus ID 227541)
TR514852 1 Kit

Camk1d Mouse shRNA Plasmid (Locus ID 227541)

Sign In for Pricing
View Details