Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22)

This Recombinant Human Protein POLR1D, isoform 2 (RPC22) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2/HER2 (C-Fc)
CX68-50ug 50 µg

Recombinant Human Receptor Tyrosine-Protein Kinase ErbB-2/HER2 (C-Fc)

Sign In for Pricing
View Details
PSMA5 Polyclonal Antibody, Cy5.5 Conjugated
bs-9354R-Cy5.5 100 µL

PSMA5 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
HOXA3 Rabbit Polyclonal Antibody (Biotin)
orb2129881 100 µL

HOXA3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
GPRC6A Overexpression Lysate (Native) - (Dry Ice)
NBL1-11306 0.1 mg

GPRC6A Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Calpain 12 CRISPR/Cas9 KO Plasmid (m)
sc-425638 20 µg

Calpain 12 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
anti-MAD2L2
YF-PA16980 100 ul

anti-MAD2L2

Sign In for Pricing
View Details