Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA3 Rabbit Polyclonal Antibody (Biotin)

HOXA3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mo-1, Mo-10, Hox-1., Hox-1.5

UniProt

P02831

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse HOXA3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YDSSAIYGGYPYQAANGFAYNASQQPYAPSAALGTDGVEYHRPACSLQSP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans ins-23 Polyclonal Antibody
MBS7192263 Inquire

Rabbit anti-Caenorhabditis elegans ins-23 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal ZFP64 Antibody (PCRP-ZFP64-1H2) [Alexa Fluor 647]
NBP3-08648AF647 100 µL

Mouse Monoclonal ZFP64 Antibody (PCRP-ZFP64-1H2) [Alexa Fluor 647]

Sign In for Pricing
View Details
Ice2 Mouse shRNA Lentiviral Particle (Locus ID 93697)
TL515044V 500 µL Each

Ice2 Mouse shRNA Lentiviral Particle (Locus ID 93697)

Sign In for Pricing
View Details
TREM1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb971329 100 µL

TREM1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit B-3 (NFYB3)
MBS1242044-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit B-3 (NFYB3)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit B-3 (NFYB3)
MBS1242044-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit B-3 (NFYB3)

Sign In for Pricing
View Details