Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXA3 Rabbit Polyclonal Antibody (Biotin)

HOXA3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mo-1, Mo-10, Hox-1., Hox-1.5

UniProt

P02831

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse HOXA3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YDSSAIYGGYPYQAANGFAYNASQQPYAPSAALGTDGVEYHRPACSLQSP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (HRP)
K0100-01A 500 µg

Kappa Light Chain (HCAK1, Ig kappa Chain C Region, IGKC, Immunoglobulin kappa Constant Region, Immunoglobulin kappa Light Chain, Kappa 1 Immunoglobulin Light Chain, Km, MGC111575, MGC62011, MGC72072, MGC88770, MGC88771, MGC88809) (HRP)

Sign In for Pricing
View Details
Mouse Sex Determining Region Y Box Protein 3 ELISA Kit
MBS729183-01 48 Well

Mouse Sex Determining Region Y Box Protein 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Sex Determining Region Y Box Protein 3 ELISA Kit
MBS729183-02 96 Well

Mouse Sex Determining Region Y Box Protein 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Sex Determining Region Y Box Protein 3 ELISA Kit
MBS729183-03 5x 96 Well

Mouse Sex Determining Region Y Box Protein 3 ELISA Kit

Sign In for Pricing
View Details
Mouse Sex Determining Region Y Box Protein 3 ELISA Kit
MBS729183-04 10x 96 Well

Mouse Sex Determining Region Y Box Protein 3 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal CD35 Antibody (CR1/4382R)
NBP3-07753-100ug 100 µg

Rabbit Monoclonal CD35 Antibody (CR1/4382R)

Sign In for Pricing
View Details