Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B)

This Recombinant Human Beta-defensin 131B (D131B) spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal MIR16 Antibody
H00051573-B01P 0.05 mg

Mouse Polyclonal MIR16 Antibody

Sign In for Pricing
View Details
ATL65 Antibody
orb784640 2 mg

ATL65 Antibody

Sign In for Pricing
View Details
NUP107 Protein Vector (Human) (pPM-C-His)
PV105329 500 ng

NUP107 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Adonixanthin
TN11583-01 10 mg

Adonixanthin

Sign In for Pricing
View Details
Adonixanthin
TN11583-02 50 mg

Adonixanthin

Sign In for Pricing
View Details
Human IL-4 Allophycocyanin Antibody (Clone 1067629)
IC11474A-100 100 Tests

Human IL-4 Allophycocyanin Antibody (Clone 1067629)

Sign In for Pricing
View Details